PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00786g00439.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 97aa    MW: 11772.7 Da    PI: 9.3782
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00786g00439.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.39.8e-104180445
                              S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
           Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                              +T++E++l+++ +k+ G + W +Ia +++ gRt++++  +w 
  Peaxi162Scf00786g00439.1 41 MTKQEEDLIYRMHKLVGDR-WGLIAGRIP-GRTAEEIERFWI 80
                              69***************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.8E-73785IPR001005SANT/Myb domain
CDDcd001679.08E-74079No hitNo description
PfamPF002496.6E-94180IPR001005SANT/Myb domain
SuperFamilySSF466892.18E-84281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-114280IPR009057Homeodomain-like
PROSITE profilePS500906.264279IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MDQNLHHQPK IMHRCCSHEV VSFVLIWKTE VNSMEWEFIS MTKQEEDLIY RMHKLVGDRW  60
GLIAGRIPGR TAEEIERFWI MRHSDGFAHK RRQLRKV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389265e-39AC238926.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-330o5 map 1, complete sequence.
GenBankHG9754405e-39HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755135e-39HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009623671.14e-53PREDICTED: MYB-like transcription factor ETC3
RefseqXP_009761639.14e-53PREDICTED: MYB-like transcription factor ETC3
RefseqXP_016464336.14e-53PREDICTED: MYB-like transcription factor ETC3
RefseqXP_016502110.14e-53PREDICTED: MYB-like transcription factor ETC3
SwissprotQ8GV052e-33TRY_ARATH; Transcription factor TRY
TrEMBLK4AZV32e-48K4AZV3_SOLLC; Uncharacterized protein
STRINGSolyc01g095640.1.15e-48(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117071824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.11e-34MYB_related family protein